PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000114.1_g00032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 260aa    MW: 29527.4 Da    PI: 5.1825
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000114.1_g00032.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1287.2e-4041351128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                              +p+GfrF Pt+eelv++yL +k++g++ +++ vi+ v+iy + Pw+Lp+    + ++++++w++F++  ++ a+g ++nr t++gy
  Itr_sc000114.1_g00032.1   4 MPVGFRFYPTEEELVSFYLGNKLRGERQDIDLVIPVVNIYLHRPWELPQlagvASYGDDEQWFYFMPGPENIARGGKPNRLTTEGY 89 
                              699***************************888***************656655556889************************** PP

                      NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              Wkatg    v+s +++++g k+t+vfy+grap+g+kt+W ++ey++
  Itr_sc000114.1_g00032.1  90 WKATGCPSLVFSINNRVIGEKRTMVFYTGRAPNGTKTEWKINEYKA 135
                              ********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-453163IPR003441NAC domain
PROSITE profilePS5100545.0014163IPR003441NAC domain
PfamPF023655.2E-195134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MEDMPVGFRF YPTEEELVSF YLGNKLRGER QDIDLVIPVV NIYLHRPWEL PQLAGVASYG  60
DDEQWFYFMP GPENIARGGK PNRLTTEGYW KATGCPSLVF SINNRVIGEK RTMVFYTGRA  120
PNGTKTEWKI NEYKAVHGEA SASAPLSDLE LRQEFSLCRL YKKPKCDRAF DRRPLSVTAV  180
RRRIARQPPP QPPPDSVQTT AMILPQQDNN NPPANEMTGA GNISPAPEDA VIPSNNAMGT  240
QVFWDNFTPI WDWEDCFNLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-30416317165NO APICAL MERISTEM PROTEIN
1ut4_B9e-30416317165NO APICAL MERISTEM PROTEIN
1ut7_A9e-30416317165NO APICAL MERISTEM PROTEIN
1ut7_B9e-30416317165NO APICAL MERISTEM PROTEIN
3swm_A9e-30416320168NAC domain-containing protein 19
3swm_B9e-30416320168NAC domain-containing protein 19
3swm_C9e-30416320168NAC domain-containing protein 19
3swm_D9e-30416320168NAC domain-containing protein 19
3swp_A9e-30416320168NAC domain-containing protein 19
3swp_B9e-30416320168NAC domain-containing protein 19
3swp_C9e-30416320168NAC domain-containing protein 19
3swp_D9e-30416320168NAC domain-containing protein 19
4dul_A9e-30416317165NAC domain-containing protein 19
4dul_B9e-30416317165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620854.14e-84PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR39e-64NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A068UQS77e-85A0A068UQS7_COFCA; Uncharacterized protein
STRINGGLYMA03G35570.13e-77(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.24e-65NAC domain containing protein 61